PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 1035aa    MW: 117232 Da    PI: 9.3625
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454456.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3406.8e-13227304487
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      + ps+v++  +l+++ kfa+++ +++ +   l+l+ +   sW+vk+++  +  +++    Wk Fv +n+Lk gD++vF++++ 
  XP_016454456.1 227 FMQPSYVFSPFNLSMSLKFARKYFLENYR--NLVLRVPGRGSWSVKCTFGTTNAKIF----WKAFVMDNKLKPGDVCVFEVIKG 304
                     5789*******************887545..7***************8866655554....*******************8764 PP

2B347.14.2e-15478567497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + ps+v+k  +l ++ +f++++  ++ +    +l+ +   sW+v++    + ++  +++GWk Fv +n+Lk gD++vF++++ ++  + v++f
  XP_016454456.1 478 FMQPSYVSKPYNLNISATFIRKYFRDEYS--NFVLRVPGRGSWSVEC--FMGTSKAQIRSGWKAFVLDNKLKHGDVCVFEVIKVTKLLMDVTIF 567
                     6789*******************777555..69**************..334444559**********************99877776777776 PP

3B334.82.9e-11741829799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ps+v++  rl +    a+++  + +++  l+l  +   sW+vk+   k++ ++ +   Wk Fv +n+Lk gD++vF+l++ ++  l v++fr+
  XP_016454456.1 741 PSYVSTPYRLDITFLLARKYLWE-KCG-FLVLHVPGRGSWSVKYVLGKSKTKICFY--WKAFVLDNKLKFGDVCVFELIKGTKPILDVTIFRT 829
                     66666666666666667666322.233.588899999*******999999999999..*********************88777788888885 PP

4B349.76.8e-169401026794
                      .-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3    7 psdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94  
                      ps+v++     +l++  + a+++   k++  +++l+++s rsW vk+  + +     lt+GWkeFv +n+Lkeg ++vF++++rs+  ++v
  XP_016454456.1  940 PSYVSSAsgpMQLSITLPIARKFFATKHS--DVILQNSSKRSWAVKC--SLGTVNAKLTSGWKEFVLDNDLKEGHICVFERVSRSKLLFNV 1026
                      44444445667899999999999766444..8***************..55555677***********************88776664444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.771165IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-11576IPR015300DNA-binding pseudobarrel domain
CDDcd100177.43E-6563No hitNo description
SuperFamilySSF1019364.71E-10565IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.3E-16217313IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.44E-15217307IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-14222315No hitNo description
SMARTSM010197.8E-9223317IPR003340B3 DNA binding domain
PROSITE profilePS508639.22224317IPR003340B3 DNA binding domain
PfamPF023622.8E-10226304IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-21467570IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-19468568IPR015300DNA-binding pseudobarrel domain
CDDcd100174.21E-15473568No hitNo description
SMARTSM010196.8E-11474570IPR003340B3 DNA binding domain
PROSITE profilePS5086311.773475570IPR003340B3 DNA binding domain
PfamPF023625.7E-12477567IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-16727828IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.51E-16728828IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.123735830IPR003340B3 DNA binding domain
SMARTSM010191.8E-6738830IPR003340B3 DNA binding domain
CDDcd100175.41E-13739828No hitNo description
PfamPF023621.5E-8741828IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-229261030IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-189291030IPR015300DNA-binding pseudobarrel domain
CDDcd100172.00E-149321029No hitNo description
PROSITE profilePS5086312.4789371032IPR003340B3 DNA binding domain
SMARTSM010196.9E-99371032IPR003340B3 DNA binding domain
PfamPF023628.4E-149441028IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1035 aa     Download sequence    Send to blast
MLNPVYLEVP TGEVWEVEVV HSQGQICLGI GWQDFSDFYS ISCGHFLMFG YNARSHFNVT  60
IFDLSASEIE YPYSSAHGIH TPISYSHETR HAPERDQSES DDSVEILEGI PRSQKANPII  120
PDMVENSVEN LDHCPLGQSS KRQRQEGDTE DDVFVDMHIK RMKVEKLQED VASFTREGQK  180
SSEGCCTHMQ QSKIVYDENK TVMDKERAIA YQRAKGFKSK NPFVISFMQP SYVFSPFNLS  240
MSLKFARKYF LENYRNLVLR VPGRGSWSVK CTFGTTNAKI FWKAFVMDNK LKPGDVCVFE  300
VIKGAKILMD ITIFPAAGST PMHKIAGEVP WVSDKSVPFS QSRIVQTKNL KQRRGGVCGF  360
NSKVKAEHGE GIGIEHSFEI LGHCPLGQYR KITRLERDAE DDVPFDTHTK NIKVETSQED  420
VALPSFRKTK KSGESCRMHT QQTTIVCGKN KTVMDKERAM AYQRAKAFKS KNPFIISFMQ  480
PSYVSKPYNL NISATFIRKY FRDEYSNFVL RVPGRGSWSV ECFMGTSKAQ IRSGWKAFVL  540
DNKLKHGDVC VFEVIKVTKL LMDVTIFPAT GSTPMLKIAG EVTGVSDSKR KIIKTDIYVP  600
CSPPKVVHTN RLKQRRGEEH DEGTGIESSV EILGHCPLGH DSKIKRLEVE TEDDVSIDIH  660
AKNIKVANTQ EDVASPSFTR KTKNFEFLYE ESGESCRMDK QQSKMVYDKN TTVLDKERTV  720
AYQRAKDFKS ENPYVMYFMQ PSYVSTPYRL DITFLLARKY LWEKCGFLVL HVPGRGSWSV  780
KYVLGKSKTK ICFYWKAFVL DNKLKFGDVC VFELIKGTKP ILDVTIFRTA ESKPVHKIDG  840
KLSGVSDCKN KTIKTENSVP CSQSKIVRSR KLNLEKRQNG NSDGFTSKTK EELSEDAGKH  900
VQQSKSSCKG SAVAKEMVLA YQRAKAFTSE NPFFICFMQP SYVSSASGPM QLSITLPIAR  960
KFFATKHSDV ILQNSSKRSW AVKCSLGTVN AKLTSGWKEF VLDNDLKEGH ICVFERVSRS  1020
KLLFNVIIFT SAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A8e-1644883122144B3 domain-containing transcription factor VRN
4i1k_B8e-1644883122144B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454456.10.0PREDICTED: uncharacterized protein LOC107778682 isoform X4
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-26B3 family protein